PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g050930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 287aa    MW: 31883.7 Da    PI: 8.7413
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g050930.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.91.9e-19130184256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q  +Lee F+ +++++ ++++ LAk+lgL  rqV vWFqNrRa+ k
  Csa12g050930.1 130 RKKLRLSKDQSAILEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTK 184
                     788899***********************************************98 PP

2HD-ZIP_I/II124.35.6e-40130219191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlsk+q+++LEe+F+ +++L+p++K++la++Lgl++rqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+kev+eLr +l
  Csa12g050930.1 130 RKKLRLSKDQSAILEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTKLKQTEVDCEFLRRCCENLTEENRRLQKEVTELR-AL 219
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046183.5E-282108IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.8E-1899187IPR009057Homeodomain-like
PROSITE profilePS5007117.427126186IPR001356Homeobox domain
SMARTSM003895.2E-16128190IPR001356Homeobox domain
SuperFamilySSF466894.28E-18128195IPR009057Homeodomain-like
PfamPF000467.8E-17130184IPR001356Homeobox domain
CDDcd000862.18E-15130187No hitNo description
PRINTSPR000311.2E-5157166IPR000047Helix-turn-helix motif
PROSITE patternPS000270161184IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5166182IPR000047Helix-turn-helix motif
SMARTSM003403.8E-26186229IPR003106Leucine zipper, homeobox-associated
PfamPF021838.4E-11186220IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MMLEKDDLGL SLGLNYQKKQ MNLKPNPSVV SVAPSSSSFG LPRRSSWNES FTSSVPNSDS  60
SQKETRTFIR GIDVNIPPST TEYGDEDAGV SSPNSTVSSS TGKRSEREED TDPQGSRGGI  120
SDDEDGDNSR KKLRLSKDQS AILEETFKDH STLNPKQKQA LAKQLGLRAR QVEVWFQNRR  180
ARTKLKQTEV DCEFLRRCCE NLTEENRRLQ KEVTELRALK LSPQFYMHMS PPTTLTMCPS  240
CEHVSVPPPP QAATSVHHRG SLPVNAWAPA ARISHGLTFD ALRPRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128134SRKKLRL
2178186RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3754530.0AF375453.1 Arabidopsis thaliana AT4g16780/dl4415w mRNA, complete cds.
GenBankATHHOMEOA0.0M90394.1 Arabidopsis thaliana heomeobox protein (HAT4) mRNA, complete cds.
GenBankAY0817470.0AY081747.1 Arabidopsis thaliana AT4g16780/dl4415w mRNA, complete cds.
GenBankX681450.0X68145.1 A.thaliana Athb-2 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010449718.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-179HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLQ9LEM21e-171Q9LEM2_9BRAS; Putative uncharacterized protein
STRINGAT4G16780.11e-177(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15632690
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-172homeobox protein 2